<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL120 06_PL120V2 South Africa 2006 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 NVP 1
2 None NA
3 NVP 1
4 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, E28ED, V35T, E36A, T39E, S48T, K122E, D123G, K173T, D177E, I178M, T200A, Q207N, R211K, K238R, V245H, D250E, A272Q, T286A, E291D, V292I, I293V A129AG, P150PS
>06_PL120V2| codons 1-299
PISPIETVPVKLKPGMDGPRVKQWPLTDEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTGFTIPSINNETPGIRYQYNVLSQGWKGSPAIFQSSMTKILEPFRTQNPEMVI
YQYMDDLYVGSDLEIGQHRAKIEELRNHLLKWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIHLPEKESWTVNDIQKLVGKLNWASQIYQGIKVKQLCKLLRGAKALTDIVPLTEEA

References
Author Title Citation
Seoighe, C A model of directional selection applied to the evolution of drug resistance in HIV-1. Mol Bio Evol, 2007