<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1626 CA8198 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 91
2 DDI 17
3 AZT 21
4 3TC+AZT 30
5 3TC+AZT+SQV 30
6 3TC+AZT+IDV 105
7 3TC+AZT+IDV 17

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q     K20R, V35T, V60I, V106I, D123E, I135IV, S162C, K166R, I178L, Q197E, F214L, D218E, A272P, K277R W24WC
>CA8198| codons 1-287
PISPIETVPVKLKPGMDGPRVKQCPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTRILEPFRKQNPDLVI
YQYVDDLYVGSDLEIGEHRTKIEELRQHLLRWGLTTPEQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84IV   L10I, N37X, K55KR, L63T, H69Q, A71AV  
>CA8199| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMXLPGRWKPKMIGGIGGFIRVRQYD
QITIEICGQKVIGTVLVGPTPVNVIGRNLLTQIGCTLNF

References
Author Title Citation
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005