<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CM72 CBN_CM72 Cameroon 1999 HIV1 F PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, I15V, K20R, M36I, N37D, I62V, L63P, I72T, L89M, I93L  
>CBN_CM72| codons 1-99
PQITLWQRPVVTVKVGGQLREALLDTGADDTVLEEIDLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKATGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Ndongmo, CB HIV genetic diversity in Cameroon: possible public health importance. ARHR, 2006