<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CM197 CBN_CM197 Cameroon 1999 HIV1 CRF02_AG PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    M36I, N37S, R41K, H69K, L89M, I93L  
>CBN_CM197| codons 21-99
EALLDTGADDTVLEEISLPGKWKPKMIGGIGGFIKVRQYDQILIEICGKKAIGTVLVGPT
PVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Ndongmo, CB HIV genetic diversity in Cameroon: possible public health importance. ARHR, 2006