<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CM114 CBN_CM114 Cameroon 1999 HIV1 CRF02_AG PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    V11L, T12Q, I13L, K14R, K20I, M36I, N37E, R41K, H69K, T80A, L89M, I93L  
>CBN_CM114| codons 1-99
PQITLWQRPLLQLRIGGQLIEALLDTGADDTVLEEIELPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPAPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Ndongmo, CB HIV genetic diversity in Cameroon: possible public health importance. ARHR, 2006