<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IB-0106 IB-0106 Spain 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC NA
2 3TC+D4T+IDV NA
3 3TC+ABC+D4T NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, N37S, R41K, I62V, L63P, V77I  
>IB-0106| codons 1-99
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMSLPGKWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215F       V35I, S48T, T69I, D123E, G196E, I202V, R211K, A272P, A288T, T290S, P294T  
>IB-0106| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEKEGKITKIGPENPYNTPV
FAIKKKNSIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKVEELRQHLWKWGFFTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKTLSEVITLTEEAE
LE

References
Author Title Citation
Ochoa de Echaguen, A Genotypic and phenotypic resistance patterns at virological failure in a simplification trial with nevirapine, efavirenz or abacavir. AIDS, 2005