<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
B-0402 B-0402 Spain 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI NA
2 3TC+AZT NA
3 3TC+AZT+SQV NA
4 3TC+D4T+IDV NA
5 3TC+D4T+EFV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   I15V, G16E, E35D, M36I, P39S, I64V  
>B-0402| codons 1-99
PQITLWQRPLVTIKVEGQLKEALLDTGADNTVLEDINLSGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219E K103N V108VI V118VI, I135T, D177E, I195L, T200AV, R211K, F214L, V245T, A272G, K277R, R284K, I293V, E297K  
>B-0402| codons 1-320
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSIPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLELGQHRVKIEELRQHLLKWGLTTPDEKHQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYGGIKVRQLCKLLKGTKALTEVVPLTKEAE
LELAENREILKEPVHGVYYD

References
Author Title Citation
Ochoa de Echaguen, A Genotypic and phenotypic resistance patterns at virological failure in a simplification trial with nevirapine, efavirenz or abacavir. AIDS, 2005