<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
B-0325 B-0325 Spain 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 3TC+D4T+IDV NA
3 3TC+D4T+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V   Y181C V108VI V118I, D123E, I135R, A158AT, G196E, R211G, F214L, H221HY, D237DN, A272P, K277R, T286A, E297R  
>B-0325| codons 1-307
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTILDVGDAYFSIPL
DKEFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPTIFQSSMTKILEPFRKQNPDIVI
CQYVDDLYVGSDLEIEQHRTKIEELRQHLLGWGLTTPDKKYQKEPPFLWMGYELHPNKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVIPLTREAE
LELAENR

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, L33V, L63P, I64V, H69K, I93L  
>B-0325| codons 1-99
PQITLWQRPLVSIKIGGQLKEALLDTGADDTVVEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPVEICGKKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Ochoa de Echaguen, A Genotypic and phenotypic resistance patterns at virological failure in a simplification trial with nevirapine, efavirenz or abacavir. AIDS, 2005