<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
B-0258 B-0258 Spain 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NFV NA
2 3TC+D4T+EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V A62V K103N P225H, K238KT K122E, K166KR, E194EK, G196EK, L210F, R211K, A272P, K277R, I293V  
>B-0258| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FVIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLKIKQHRTKIEELRQHLFKWGFTTPDKKHQKEHPFLWMGYELHPDTWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, L90M   L10LI, N37S, P39Q, R41K, D60E, I62V, L63P, I64V, V77I, I93IL  
>B-0258| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMSLQGKWKPKIIGGIGGFIKVRQYE
QVPVEICGHKAIGTVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Ochoa de Echaguen, A Genotypic and phenotypic resistance patterns at virological failure in a simplification trial with nevirapine, efavirenz or abacavir. AIDS, 2005