<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
B-0181 B-0181 Spain 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+RTV+SQV NA
2 3TC+D4T+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184MI   K103KN, Y181YC   K11R, K43KQ, A98S, E203D, A272P, L310I  
>B-0181| codons 1-315
PISPIETVPVRLKPGMDGPKVKQWPLTEEKIKALVEICTEMEQEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYIDDLYVGSDLEIGQHRTKIDELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREIIKEPVH

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, R41RK, Q61H, L63P, I72EV  
>B-0181| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
HIPIEICGHKAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Ochoa de Echaguen, A Genotypic and phenotypic resistance patterns at virological failure in a simplification trial with nevirapine, efavirenz or abacavir. AIDS, 2005