<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2249 CA8160 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 39
2 3TC+ AZT+ RTV 13
3 3TC+ AZT+ IDV 43
4 D4T+ DDI+ NVP 76

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, M184V   K103N, Y181YC   V90I, I135V, T139TR, G196E, T200A, T215X  
>CA8160| codons 1-258
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNERPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYVDDLYVGSDLEIEQHRAKIEELRQHLLRWGFXTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, E35D, N37DE, L63T, I64V  
>CA8161| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFIKVRQYD
QITVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: classification, amino acid mutation patterns, and prevalence in a Northern California clinic-based population. J Infect Dis, 2001
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005