<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1481 CA8159 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 10
2 3TC+AZT+IDV 52
3 AZT+3TC+NVP+NFV 7
4 3TC+AZT+NFV+SQV 17
5 3TC+NFV+SQV 4
6 3TC+NFV+RTV+SQV 4
7 NFV+RTV+SQV 4
8 NFV+SQV 21
9 3TC+ABC+DDI+EFV 27

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M   K20I, E35D, M36I, I62V, L63P, G73X  
>CA8159| codons 1-99
PQITLWQRPLVTIKIGGQLIEALLDTGADDTVLEDINLPGRWKPKIIGGIGGFIKVRQYD
QVPIEICGHKAIXTVLVGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, M184V, T215F K219E K103N, Y181C V108I, P225PH K122E, I135IT, I142V, L228R  
>CA8158| codons 1-264
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFFTPDEKHQKEHPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005