<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2248 CA8152 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 DDI 30
3 3TC+ D4T 39
4 IDV+ AZT+ 3TC 52
5 NFV+ DDI+ D4T 45

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, L90M   L10I, K20M, M36V, D60E, Q61E, L63P, I64V, C67S, V82VI, I93L  
>CA8152| codons 1-99
PQITLWQRPIVTIKIGGQLMEALLDTGADDTILEEVNLPGRWKPKIVGGIGGFIKVRQYE
EIPVEISGHKAIGTVLVGPTPINIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y       K20R, V35L, T39A, E44D, A98S, V118I, K122E, I135T, T200A, H208Y, I257L, Q278QH T253TS, K259K*, N265NT
>CA8151| codons 1-283
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALLEICAELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRQYLWRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWSVNDLQ*LVGKLTWASQIYAGIKVKHLCKLL

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005