<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pt5 FDB_Pt5 Botswana 2005 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NVP NA
2 3TC+AZT+RTV+SQV 39
3 D4T+DDI+NFV 65

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y   K103KN, Y188L   V35T, E36A, T39D, S48T, V60I, V118VI, K122E, D123N, I135RT, K173A, Q174K, D177E, T200A, Q207E, R211K, V245Q, E248D, A272P, K277R, T286A, E291D  
>FDB_Pt5| codons 1-321
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICDELEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIVI
YQYMDDLLVGSDLEIGQHRAKIEELREHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDVIPLTEEAE
LELAENREILKEPVHGVYYDP

References
Author Title Citation
Doualla-Bell, F High prevalence of the K65R mutation in human immunodeficiency virus type 1 subtype C isolates from infected patients in Botswana treated with didanosine-based regimens. AAC, 2006