<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pt21 FDB_Pt21 Botswana 2005 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NVP 96
2 D4T+DDI+NFV 35

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q Y181C A98G V35T, T39AE, S48E, D123E, I135T, K173A, D177E, I178L, T200A, E203EK, Q207E, F214FL, H221Y, V245Q, A272P, K277R, T286A, E291D, V292I, I293V N306ND
>FDB_Pt21| codons 1-321
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKIEKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPELVI
CQYVDDLYVGSDLEIGQHRAKIKELREHLLRWGLTTPDQKYQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAEDREILKEPVHGVYYDP

References
Author Title Citation
Doualla-Bell, F High prevalence of the K65R mutation in human immunodeficiency virus type 1 subtype C isolates from infected patients in Botswana treated with didanosine-based regimens. AAC, 2006