<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pt6 FDB_Pt6 Botswana 2005 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+EFV 9
2 D4T+DDI+EFV 17

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, K70R, Q151LM V75I, F116Y K103N, V106VA   V35Q, T39D, S48T, V60I, S68SG, T69TI, K122E, I135T, E138A, I142T, K173A, Q174K, D177E, I178LV, G196E, T200A, Q207E, R211K, F214L, V245K, D250E, A272P, E291D, V292I, I293V, V317A P1PA, L26LS
>FDB_Pt6| codons 1-321
AISPIETVPVKLKPGMDGPKVKQWPSTEEKIKALQEICDEMEKEGKITKIGPENPYNTPI
FAIKRKDGIRWRKLIDFRELNKRTQDFWEVQLGIPHPAGLKKNKSATVLDVGDAYYSVPL
DEDFRKYTAFTIPSTNNATPGTRYQYNVLPMGWKGSPAIFQSSMTKILEPFRAKNPEVVI
YQYMDDLYVGSDLEIEQHRAKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGAYYDP

References
Author Title Citation
Doualla-Bell, F High prevalence of the K65R mutation in human immunodeficiency virus type 1 subtype C isolates from infected patients in Botswana treated with didanosine-based regimens. AAC, 2006