<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pt22 FDB_Pt22 Botswana 2005 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NVP 65
2 D4T+DDI+NFV 70

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, T215F K219E Y181C A98G, V108I V35T, T39E, L109I, K122E, D123S, K173A, D177E, Q197K, T200A, I202V, R211K, D218E, V245Q, A272P, K277R, A288T, E291D, V292I, I293V  
>FDB_Pt22| codons 1-321
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTIIDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEIVI
CQYMDDLYVGSDLEIGKHRAKVEELRQHLLKWGFFTPEEKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKTLTDIVPLTEEAE
LELAENREILKEPVHGVYYDP

References
Author Title Citation
Doualla-Bell, F High prevalence of the K65R mutation in human immunodeficiency virus type 1 subtype C isolates from infected patients in Botswana treated with didanosine-based regimens. AAC, 2006