<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pt17 FDB_Pt17 Botswana 2005 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+EFV 70
2 D4T+DDI+NFV 39

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74LV, M184MV, T215Y V75M K103N, G190A K101H P4S, V35T, E36A, T39E, S48T, V60VI, V90I, K122E, I135V, S162A, K173A, D177E, Q197K, Q207E, R211K, V245Q, A272P, T286A, E291D, I293V, E297D  
>FDB_Pt17| codons 1-321
PISSIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEELEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKVMDFRELNKRTQDFWEIQLGIPHPAGLHKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRAQNPEIVI
YQYVDDLYVASDLEIGKHRTKIEELREHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDVVPLTDEAE
LELAENREILKEPVHGVYYDP

References
Author Title Citation
Doualla-Bell, F High prevalence of the K65R mutation in human immunodeficiency virus type 1 subtype C isolates from infected patients in Botswana treated with didanosine-based regimens. AAC, 2006