<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
H3117 DR_H3117 France 2005 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+TDF 104

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, K20R, M36I, R41K, H69K, L89I, I93L  
>DR_H3117| codons 4-99
TLWQRPLVSIKVGGQLREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQIL
IEICGKKAIGTVLVGPTPVNIIGRNILTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, Y115YF, M184MV A62AV, K70KT     V35L, E36N, I37F, T39E, S48T, S68R, V118I, T139A, K166R, K173T, D177E, T200E, Q207E, R211K, F214L, L228LR, V245T  
>DR_H3117| codons 35-247
LNFCEEMEKEGKITKIGPENPYNTPVFVIKRKDRTTWRKLVDFRELNKRTQDFWEVQLGI
PHPAGLKKKKSVTVLDVGDAFFSIPLDKDFRKYTAFTIPSINNEAPGIRYQYNVLPQGWK
GSPAIFQSSMTRILEPFRTQNPEIVIYQYVDDLYVGSDLEIGQHREKIEELREHLLKWGL
TTPDKKHQKEPPFRWMGYELHPDKWTVQPITLP

References
Author Title Citation
Rey, D Virologic response of zidovudine, lamivudine, and tenofovir disoproxil fumarate combination in antiretroviral-naive HIV-1-infected patients. JAIDS, 2006