<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pt6128 6128 Peru 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33I L10I, V11T, N37D, R57K, Q61E, I62V, L63P, I64L, A71V, V77T, I93L  
>6128| codons 1-99
PQITLWQRPITTIKIGGQLKEALLDTGADDTVIEEMDLPGRWKPKMIGGIGGFIKVKQYD
EVPLEICGHKVIGTVLTGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, T39N, K104KR, I178M, T200E, K201R, E204K, R211K, T286TA, E297A, K311R  
>6128| codons 1-335
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICNEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIGQHRERIEKLRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVIPLTAEAE
LELAENREILREPVHGVYYDPSKDLIAEIQKQGQG

References
Author Title Citation
Lama, JR Linking HIV and antiretroviral drug resistance surveillance in Peru: A model for a third-generation HIV sentinel surveillance. JAIDS, 2006