<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pt4539 4539 Peru 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI|PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D R41K, K45KR, Q61E, L63P, I64L, A71AT, I72IT, V82VI, I93L  
>4539| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADNTVLEEMNLPGKWKPRMIGGIGGFIKVRQYD
EIPLEICGHKTTGTVLVGPTPINIIGRDLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, D67N, K70R, M184V, T215F K219Q     E6ED, K11KQ, K20R, V60VI, T200TI, R211K, D218E, K311R, I326V, Q334H  
>4539| codons 2-335
ISPIDTVPVQLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPIF
AIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIY
QYVDDLYVGSDLEIGQHRIKIEELRQHLLKWGFFTPEQKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTEEAEL
ELAENREILREPVHGVYYDPSKDLVAEIQKQGHG

References
Author Title Citation
Lama, JR Linking HIV and antiretroviral drug resistance surveillance in Peru: A model for a third-generation HIV sentinel surveillance. JAIDS, 2006