Isolate Data
Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
Craig-pt38 | 38W48 | Europe | 1996 | HIV1 | B | PBMC | MMC |
Treatment History
Order | Regimen | Weeks |
1 | NRTI | NA |
2 | SQV | 48 |
Protease Sequence
PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
L90M | G73S | L10I, I15V, N37S, I62V, L63P, A71V, I72T, V77I |
>38W48| codons 1-99 PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD QVPIEICGHKVTSTVLIGPTPVNIIGRNLMTQIGCTLNF |
References
Author | Title | Citation |
Craig, C | HIV protease genotype and viral sensitivity to HIV protease inhibitors following saquinavir therapy. | AIDS, 1998 |
Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |
Rhee, SY | HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. | J Infect Dis, 2005 |