Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
Treatment History
| Order | Regimen | Weeks |
| 1 | NRTI | NA |
| 2 | SQV | 48 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| L90M | G73S | L10I, I15V, N37S, I62V, L63P, A71V, I72T, V77I |
| >38W48| codons 1-99 PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD QVPIEICGHKVTSTVLIGPTPVNIIGRNLMTQIGCTLNF |
References
| Author | Title | Citation |
| Craig, C | HIV protease genotype and viral sensitivity to HIV protease inhibitors following saquinavir therapy. | AIDS, 1998 |
| Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |
| Rhee, SY | HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. | J Infect Dis, 2005 |