<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pt4043 4043 Peru 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   T12S, L19Q, R41K, L63P, I93L  
>4043| codons 1-99
PQITLWQRPLVSIKIGGQQKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K101E, K103N   T27S, E28K, T39S, D121Y, K122E, D177E, E203K, R211K, V245E, I293V, E297T, V317A, I329V  
>4043| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLSKEKIKALVEICSEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKNKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRTKIKELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTTEAE
LELAENREILKEPVHGAYYDPSKDLIAEVQKQGQG

References
Author Title Citation
Lama, JR Linking HIV and antiretroviral drug resistance surveillance in Peru: A model for a third-generation HIV sentinel surveillance. JAIDS, 2006