<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Craig-pt10 10W60 Europe 1996 HIV1 B PBMC MMC

Treatment History
Order Regimen Weeks
1 NRTI NA
2 SQV 60

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82A   T74S  
>10W60| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGSVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Craig, C HIV protease genotype and viral sensitivity to HIV protease inhibitors following saquinavir therapy. AIDS, 1998
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005