<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SE6594 SE6594 Sweden 1993 HIV1 A PBMC None

Treatment History
Order Regimen Weeks
1 AZT+DDI 80

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15V, K20R, E35D, M36I, R41K, R57K, H69K, L89M  
>SE6594| codons 1-99
PQITLWQRPLVTVKVGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, A21T, V32I, M50I, I72V, T112V, I113V, T124A, T125A, G134N, K136Q, D167E, V201I, K211R, T218I, L234I S283G
>SE6594| codons 1-288
FLDGIDKAQEEHERYHSNWRTMASDFNLPPVIAKEIVASCDKCQLKGEAIHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVVHTDNGSN
FTSAAVKAACWWANIQQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTRELQKQIIKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

References
Author Title Citation
Carr, JK Characterization of subtype A HIV-1 from Africa by full genome sequencing. AIDS, 1999