<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SE8891 SE8891 Sweden 1995 HIV1 A PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15V, E35D, M36I, R41K, K43R, R57K, L63S, H69K, L89M  
>SE8891| codons 1-99
PQITLWQRPLVTVKVGGQLKEALLDTGADDTVLEDINLPGKWRPKMIGGIGGFIKVKQYD
QISIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11T, K20R, V21I, V35T, T39R, Q91X, L92X, G93X, I94X, D123N, T165I, K173V, D177E, V179I, T200A, I202V, Q207A, R211S, V245Q, E248N, D250E, S251N, A272V, T286A, E291D, V292I, I293V, P294T, E312D, G335D, M357K, G359S, K366R, T369V, A371V, I375V, A376V, T377M, A400T, T403M, E404D, E432D, S468T, T470A, D471E, Q480H, H483Y, L491S, K512R, S519N, Q524K, K527G, E529D, A534S, I556V, K558R, V559I V90VIL
>SE8891| codons 1-560
PISPIETVPVTLKPGMDGPRIKQWPLTEEKIKALTEICREMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWELXXXXPHPAGLKKKKSVTVLDVGDAYFSVPL
DKNFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRVQNPEIII
YQYMDDLYVGSDLEIGQHRAKVEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPNKENWTVNDIQKLVGKLNWASQIYVGIKVKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKDPVHGVYYDPSKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYARKRSA
HTNDVRQLVEVVQKVVMESIVIWGKTPKFKLPIQKETWETWWMDYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIVGAETFYVDGAANRETKLGKAGYVTDRGRQKVVTLAETTNQKTELH
AIYLALQDSGSEVNIVTDSQYALGIIQAQPDRSESELVNQIIEKLIGKDKVYLSWVPAHK
GIGGNEQVDKLVSAGVRRIL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, A21T, V31I, I60M, I72V, T112V, I113V, T124A, T125A, V126F, G134N, I135V, K136Q, D167E, V201I, V250L, D279G S283G
>SE8891| codons 1-288
FLDGIDKAQEEHERYHSNWRTMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGM
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVVHTDNGSN
FTSAAFKAACWWANVQQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVLIQDNSDIKVVPRRKAKIIRDYGKQMAGDGCVAGRQDED

References
Author Title Citation
Carr, JK Characterization of subtype A HIV-1 from Africa by full genome sequencing. AIDS, 1999