<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
260Pt9 260Pt9W8C U.S. 1996 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 DLV 8

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    Y181C   K49R, I135V, S162C, T200A, R211K  
>260Pt9W8C| codons 37-245
ICTEMEKEGKISRIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPH
PAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGS
PAIFQCSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRAKIEELRQHLLKWGFTT
PDKKHQKEPPFLWMGYELHPDKWTVQPIV

References
Author Title Citation
Demeter, LM Delavirdine susceptibilities and associated reverse transcriptase mutations in human immunodeficiency virus type I isolates from patients in a phase I/II trial of delavirdine monotherapy (ACTG 260). AAC, 2000
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005