<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2213 CA8018 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 74
2 D4T+NFV+NVP 41

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T215FI   Y188L   V118I, K122E, I135T, R211K, F214L, A272P, V276T, Q278QH, L283I K275KN
>CA8018| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLLVGSDLEIGQHRTKIEELRQHLLKWGLFTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGINTKHLCKLIRGTKALTEVIPLTEEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82T, L90M   L10I, E35D, N37D, L63P, I64V, C67S, A71V, I72V, I93L  
>CA8019| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDMDLPGRWKPKIIGGIGGFVKVRQYD
QIPVEISGHKVVGTVLVGPTPTNIIGRNLMTQLGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012