<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2210 CA8010 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 IDV 34
2 D4T+ DDC+ NFV 65
3 D4T+ DDC 21
4 AZT+ 3TC+ NFV 27

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   E35D, M36I, R57K, L63P  
>CA8010| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADNTVLEDINLPGRWKPKMIGGIGGFIKVKQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y       R83K, K122E, D123N, I135T, S162C, T200E, E204A, Q207N, R211K  
>CA8009| codons 1-258
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHREKIEALRNHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQ

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001