<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pt1 FDB_Pt1 Botswana 2005 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC|AZT|NNRTI NA
2 D4T+DDI+NFV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   T12S, I15V, G16A, L19I, K20T, E35D, M36I, R41K, K45Q, D60E, C67E, H69K, L89IM, I93L  
>FDB_Pt1| codons 1-99
PQITLWQRPLVSIKVAGQITEALLDTGADNTVLEDINLPGKWKPQMIGGIGGFIKVRQYE
QILIEIEGKKAIGTVLVGPTPVNIIGRNILTQLGCTLNF

References
Author Title Citation
Doualla-Bell, F Impact of human immunodeficiency virus type 1 subtype C on drug resistance mutations in patients from Botswana failing a nelfinavir-containing regimen. AAC, 2006