<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1461 CA7997 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 30
2 DDI+ AZT 17
3 DDC+ AZT 40
4 SQV+ DDC+ AZT 103
5 3TC+ AZT 14
6 IDV+ D4T+ 3TC 34
7 DDI+ NVP+ D4T 23
8 SQV+ RTV 60
9 NFV+ SQV+ 3TC+ DDI 17

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L90M F53L, G73T L10I, D60E, I62V, L63P, A71I, V77I, I93L  
>CA7997| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGLVKVRQYE
QVPIEICGHKIITTVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, T69AD, M184V, L210W, T215Y V75VL Y181YC   K20R, V21I, T39A, E40FV, K43E, K66KR, K101KQ, V118I, K122E, D177E, I178M, T200A, Q207E, H208Y, R211K  
>CA7996| codons 1-257
PISPIETVPVKLKPGMDGPRIKQWPLTEEKIKALVEICAFLEEEGKISKIGPENPYNTPV
FAIKKRNSAKWRKLLDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
CQYVDDLYVGSDLEIGQHRAKIEELREYLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDI

References
Author Title Citation
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005