<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
HM_C11 HM_C11 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 RTV|SQV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84C L24I L10I, L63H  
>HM_C11| codons 1-99
PQITLWQRPIVTIKIGGQLKEALIDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIHIEICGHKAIGTVLVGPTPVNCIGRNLLTQIGCTLNF

References
Author Title Citation
Mo, H Identification and structural characterization of I84C and I84A mutations that are associated with high-level resistance to HIV protease inhibitors and impair viral replication. AAC, 2006