<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
HM_C9 HM_C9 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 RTV|SQV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54L, I84C L24LI L10V, L63P  
>HM_C9| codons 1-99
PQITLWQRPVVTIKIGGQLKEALIDTGADDTVLEEMNLPGRWKPKLIGGIGGFLKVRQYD
QIPIEICGHKAIGTVLVGPTPVNCIGRNLLTQIGCTLNF

References
Author Title Citation
Mo, H Identification and structural characterization of I84C and I84A mutations that are associated with high-level resistance to HIV protease inhibitors and impair viral replication. AAC, 2006