<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
01NGPL0674 01NGPL0674 Nigeria 2001 HIV1 G PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, E35Q, M36I, N37D, R41K, R57K, L63P, C67E, H69K, V82I, L89M  
>01NGPL0674| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEQIDLPGKWKPKMIGGIGGFIKVKQYD
QIPIEIEGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E40D, K49R, V60I, K102R, K104R, K122E, D123N, A158S, K173T, Q174K, D177E, T200A, Q207E, R211K, V245Q, E248N, D250E, A272P, T286A, E291D, V292I, I293V, P294T, Q334L, G335D, F346H, R356K, M357R, R358G, G359T, T377Q, T386V, Q394R, A400V, E413D, K431T, V435P, F440Y, L452V, R461K, R463K, V466I, V467L, S468T, L469I, T470Q, D471E, Q480H, H483Q, L491S, K512R, E516A, S519N, A534T, A554S  
>01NGPL0674| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKRSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRTKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPNKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGLDQWTYQIYQEPHKNLKTGKYAKRGTA
HTNDVKQLTEAVQKIAQESIVIWGKVPKFKLPIRKETWEVWWTEYWQATWIPDWEFVNTP
PLVKLWYQLETEPIPGAETYYVDGAANRETKVGKAGYVTDKGKQKILTIQETTNQKTELH
AIQLALQDSGSEVNIVTDSQYALGIIQAQPDRSESALVNQIIEQLIKKEKVYLTWVPAHK
GIGGNEQVDKLVSSGIRKVL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  E92A, T125K K14R, V31I, P90S, Y99F, L101I, T112I, G134N, K136T, V201I, T206S, L234I, S255N, D256E  
>01NGPL0674| codons 1-288
FLDGIDKAQEEHERYHSNWRAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVISAATGQETAFFILKLAGRWPVKIIHTDNGSN
FTSTKVKAACWWANITQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNNEIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Carr, JK HIV subtype and drug resistance patterns among drug-naive infected persons in Jos, Nigeria. Direct Genbank Submission, 2005