<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL0567 PL0567 Nigeria 2001 HIV1 G PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20I, E35Q, M36I, R41K, R57K, L63P, I64M, C67E, H69K, V82I, L89M  
>PL0567| codons 1-99
PQITLWQRPLVTVKIGGQLIEALLDTGADDTVLEQINLPGKWKPKMIGGIGGFIKVKQYD
QIPMEIEGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E28G, V35T, V60I, D121H, K122E, D123S, T139K, K173T, Q174K, D177E, I178M, V189I, T200A, Q207E, R211K, P243A, V245Q, E248D, D250E, S251D, A272S, T286A, E291D, V292I, I293V, P294S, E300A, Q334L, G335D, F346Y, R356K, M357R, R358G, G359S, A376S, T386V, Q394R, A400V, E413D, K431T, V435P, R461K, R463K, V466I, V467I, S468T, L469I, T470Q, Q480H, H483Q, L491S, K512R, S519N, A534T, A554R  
>PL0567| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTGEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HESFRKYTAFTIPSINNEKPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEMVI
YQYMDDLYIGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQAIQLPDKEDWTVNDIQKLVGKLNWASQIYSGIKVKQLCKLLRGAKALTDIVSLTEEAA
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGLDQWTYQIYQEPYKNLKTGKYAKRGSA
HTNDVKQLTEAVQKISTESIVIWGKVPKFKLPIRKETWEVWWTEYWQATWIPDWEFVNTP
PLVKLWYQLETEPIPGAETFYVDGAANRETKLGKAGYVTDKGKQKIITIQDTTNQKTELH
AIQLALQDSGSEVNIVTDSQYALGIIQAQPDRSESELVNQIIEQLIKKEKVYLTWVPAHK
GIGGNEQVDKLVSRGIRKVL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K7R, K14R, S17N, V31I, S39N, G106A, T112V, T124N, T125V, G134N, K136T, G163Q, V201I, T206S, T218N, Y227F, L234I, S255N, D256E S283G, D286E
>PL0567| codons 1-288
FLDGIDRAQEEHERYHNNWRAMASDFNLPPIVAKEIVANCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFLLKLAARWPVKVIHTDNGSN
FTSNVVKAACWWANITQEFGIPYNPQSQGVVESMNKELKKIIQQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQINKIQNFRVYFRDSRDPIWKGPAK
LLWKGEGAVVIQDNNEIKVVPRRKAKIIRDYGKQMAGDDCVAGRQEED

References
Author Title Citation
Carr, JK HIV subtype and drug resistance patterns among drug-naive infected persons in Jos, Nigeria. Direct Genbank Submission, 2005