<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1317 CA7991 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI NA
2 3TC+ AZT+ DDI NA
3 None 3
4 D4T+ DDI+ IDV 36

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
N88S   I15V, K20T, E35D, M36I, R57K, L63P, I93IL  
>CA7991| codons 1-99
PQITLWQRPLVTIKVGGQLTEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVKQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRSLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Y115F, Q151M V75I, F77L, F116Y     K49R, I50V, S68G, K122E, T200A, E203EQ, Q207E, R211K, K219T, V245T, E248D, D250E, S251X, A272P, K277R  
>CA7990| codons 1-284
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISRVGPENPYNTPV
FAIKKKDGTKWRKLIDLRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAFYSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIQELREHLLKWGFTTPDTKHQKEPPFLWMGYELHPDKWT
VQPITLPDKEXWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLR

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005