<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA35657 CA79852 U.S. 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+RTV 52
2 3TC+D4T+NFV 387
3 ATV+DDI+RTV+TDF 86

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R K219Q     P4T, K11R, M16MV, K20R, V35L, V60I, K64R, K82KR, K103R, K122E, D123DN, I135IV, G196E, Q197K, R211K, F214L, L228LH, A272P, K277KR, T286A, E297Q  
>CA79852| codons 1-301
PISTIETVPVRLKPGVDGPRVKQWPLTEEKIKALLEICTEMEKEGKISKIGPENPYNTPI
FAIRKKNSTRWRKLVDFRELNRRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEKHRTKIEELRQHLLKWGLTTPDQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVIPLTQEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, N88NS, L90M G48E, G73ST L10I, I62V, L63P, I64V, I66IV, T74S, V75VI, V77I, I93L  
>CA79851| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIEGIGGFVKVRQYD
QVPVEVCGHKAITSILIGPTPVNIIGRSLMTQLGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009