<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2197 CA7971 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 112
2 3TC+ AZT+ RTV 39
3 3TC+ D4T+ IDV 100

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82A N88D L10I, I15V, L19M, K20M, M36MI, L63P, H69Q, A71AV, V77I, I93L  
>CA7971| codons 1-99
PQITLWQRPIVTIKVGGQMMEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGQKVIGTVLIGPTPANIIGRDLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69S_SS, K70R, M184V A62V     A98S, D123E, D177E, G196R, Q207E, R211K, V245K Q85QH
>CA7970| codons 1-258
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FVIKKKDSSRWRKLVDFRELNKRTHDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIRQHRTKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQ

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005