<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2190 CA7950 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 130
2 3TC+D4T 35
3 3TC+D4T+IDV 44
4 None 44

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V K219Q     T69N, V118I, V179I, F214L, L228R, P243H, V245E  
>CA7950| codons 1-277
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDQKHQKEPPFRWMGYELHPDKWT
VQHIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I   L63P, I72IV, V77I, L89T, I93L  
>CA7951| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKAVGTVLIGPTPVNIIGRNTLTQLGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005