<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA26353 CA79456 U.S. 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI+NFV 104
2 3TC+D4T+NFV+NVP 104
3 3TC+D4T+APV+NVP 74

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, M184V, L210W, T215F K219W Y181C K101H, V108I V35K, T39A, K43E, V118I, K122KE, D123E, I135T, Q174QH, G196E, Q207E, H208Y, R211K, L228K, V245K, A272P, K277R, T286A, E297K  
>CA79456| codons 1-309
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALKEICAELEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKIVDFRELNKRTQDFWEVQLGIPHPAGLHKKKSVTILDVGDAYFSIPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKHNPDIVI
CQYVDDLYVGSDLEIEQHRTKIEELREYLWKWGFFTPDWKHQKEPPFKWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVIPLTKEAE
LELAENREI

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, I54L, L90M L10F, L33F, N88D I13V, K14R, I15V, K20T, E35D, M36I, R41I, K43RS, R57K, I62V, L63P, I66V, A71V, I72T, V77I, Q92K, I93L, C95F, T96S  
>CA79455| codons 1-99
PQITLWQRPFVTVRVGGQLTEALLDTGADNTVFEDINLPGIWSPKMIGGIGGFLKVKQYD
QVPIEVCGHKVTGTVLIGPTPVNIIGRDLMTKLGFSLNF

References
Author Title Citation
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012