<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JS97287 JS97287 Luxembourg 1997 HIV1 F Unknown Unknown

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, T12N, I15V, K20M, E35D, M36I, P39Q, R41K, R57K, Q61N, L63I, I72T, L89M, I93L  
>JS97287| codons 1-99
PQITLWQRPIVNIKVGGQLMEALLDTGADDTVLEDINLQGKWKPKMIGGIGGFIKVKQYD
NIIIEICGHKATGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Servais, J Variant human immunodeficiency virus type 1 proteases and response to combination therapy including a protease inhibitor. AAC, 2001