<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA25602 CA79443 U.S. 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 52
2 3TC+ATV+EFV+RTV+TDF 39
3 3TC+ATV+RTV+TDF 52
4 ATV+FTC+RTV+TDF 16

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M F53L, G73S K20V, L63P, A71V, V77I, I85IV  
>CA79443| codons 1-99
PQITLWQRPLVTIKIGGQLVEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGLIKVRQYD
QIPIEICGHKVISTVLIGPTPVNIVGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y D67G, K219R K101E   K20R, K43N, E44D, K64H, V118I, D123E, E138A, I178M, R211K, D218E  
>CA79444| codons 1-240
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELENDGKISKIGPENPYNTPV
FAIHKKGSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPERKHQKEPPFLWMGYELHPDKWT

References
Author Title Citation
Rhee, SY HIV-1 protease mutations and protease inhibitor cross resistance. AAC, 2010