<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
260Pt5 260Pt5W8P U.S. 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DLV 8

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N, Y181C   T27X, S68G, K122E, I135T, V179A  
>260Pt5W8P| codons 26-245
LXEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDGTKWRKLVDFRELNKRTQ
DFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQ
YNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIAICQYMDDLYVGSDLEIGQHRTKIEEL
RQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIV

References
Author Title Citation
Demeter, LM Delavirdine susceptibilities and associated reverse transcriptase mutations in human immunodeficiency virus type I isolates from patients in a phase I/II trial of delavirdine monotherapy (ACTG 260). AAC, 2000
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005