<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6031 CA79362 U.S. 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 126
2 3TC+AZT 65
3 DDI+NFV+NVP 87
4 DDI+RTV+SQV 52
5 ABC+APV+D4T+DDI+RTV 152
6 ABC+APV+DDI+RTV+TDF 87
7 ABC+DDI+APV+RTV+TDF 119

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, L210W, T215Y K70A     V35I, T39A, E40F, K43E, A98S, V118I, K122E, I135T, I142IV, G196E, H208Y, R211K, I293V V111VIM
>CA79362| codons 1-294
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAFLEEEGKISKIGPENPYNTPV
FAIKKKNSTAWRKVVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDMGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQYLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, I54L, I84V, L90M L10F, L33F, N88D I13V, K45R, L63P, I66IV, P79PS, L89LF, I93L, C95CF  
>CA79361| codons 1-99
PQITLWQRPFVTVKIGGQLKEALLDTGADNTVFEEMNLPGRWKPRMIGGIGGFLKVRQYD
QIPIEVCGHKAIGTVLVGSTPVNVIGRDFMTQLGFTLNF

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    D3E, S24G, D25E, S39C, L45V, K211R, S230N  
>CA124201| codons 1-288
FLEGIDKAQEEHEKYHSNWRAMAGEFNLPPVVAKEIVACCDKCQVKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTRELQKQITKIQNFRVYYRDNRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012