<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7885 CA79323 U.S. 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 44
2 3TC+AZT 26
3 D4T+IDV 48
4 3TC+D4T+IDV 213
5 3TC+APV+DLV+TDF 57
6 3TC+APV+TDF 52
7 3TC+APV+ATV+RTV+TDF 61
8 3TC+ATV+APV+RTV+TDF 107

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32VI, M46L, I54L, V82VA, I84V, L90M   L10I, T12P, I15V, K20R, M36I, N37D, L63P, A71V, T74TS, P79S, I85V, I93L  
>CA79323| codons 1-99
PQITLWQRPIVPIKVGGQLREALLDTGADDTILEEIDLPGRWKPKLIGGIGGFLKVRQYD
QIPIEICGHKVIGSVLVGSTPANVVGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, L210W, T215Y V75L, K219E K103N   T39A, K122E, I135T, I178IM, I195IL, G196E, T200TA, L228N, E248N, D250E, T286A, A288S, I293V  
>CA79324| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLLDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYVDDLYVGSDLELEQHRAKIEELRQHLWRWGFYTPDEKHQKEPPFNWMGYELHPDKWT
VQPIVLPNKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKSLTEVVPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease mutations and protease inhibitor cross resistance. AAC, 2010