<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2073 CA79310 U.S. 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 48
2 AZT+DDC+DDI 26
3 D4T+DDI+SQV 31
4 3TC+AZT+IDV 43
5 D4T+DDI+IDV 26
6 3TC+AZT+IDV 83
7 ABC+APV+D4T+EFV 335
8 ABC+D4T+APV 76

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, L210W, T215Y K219N K103N V108I, Y181G E6D, T27S, K43E, E44A, V90I, V118I, K122E, I142V, A158S, S162HY, V189VI, I202V, H208Y, R211K, H221Y, K223Q, L228R, V245VE, A272P  
>CA79310| codons 1-300
PISPIDTVPVKLKPGMDGPKVKQWPLSEEKIKALVEICTELEEAGKISKIGPENPYNTPV
FAIKKKNSTKWRKIVDFRELNKRTQDFWEIQLGIPHPAGLKKNKSVTILDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPSIFQYSMTKILEPFRKQNPDIVI
GQYMDDLYIGSDLEIGQHRTKVEELRQYLWKWGFYTPDNKYQQEPPFRWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54M, V82A, L90M L10FI, V11VI I13V, I15V, Q18QH, K20I, M36I, N37D, L63P, A71IV, I93L  
>CA79309| codons 1-99
PQITLWQRPIITVKVGGHLIEALLDTGADDTVLEEIDLPGRWKPKLIGGIGGFMKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    I73V, S119P, T206S, D207E, I208L  
>CA124181| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIVLVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGPN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIASELQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012