<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8340 CA79292 U.S. 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+NFV 300

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Y115F, M184V       T69A, V118I, K122KE, I135IV, Q174H, G196E, R211G, F214L, L228H, V245T, A272P, K277R, D324E, A360T, A371V, I375V, A376S, A400T, V435E, R448G, L452V, D460N, T470A, H483Y, Q547R, A554S  
>CA79292| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSAKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAFFSIPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKHNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLLGWGLTTPDKKHQKEPPFHWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGT
HTNDVKQLTEVVQKVSTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIEGAETFYVDGAANGETKVGKAGYVTNRGRQKVVSLADTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNERVDKLVSSGIRKVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I15V, M36I, I62V, L63T, I93L  
>CA79291| codons 1-99
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QVTIEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012