<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-8091 8091-30926 U.K. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M L10F, G73C I13IM, I15IV, L19Q, K20I, M36MI, N37NS, L63P, I64V, H69R, I72L  
>8091-30926| codons 1-99
PQITLWQRPFVTMKVGGQQIEALLDTGADDTVLEEISLPGRWKPKIIGGIGGFVKVRQYD
QIPVEICGRKALCTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74LV, L210W, T215Y       V35L, K43E, S68G, T69N, V118I, K122E, D123N, G196E, R211K, I293V, E297K, I329V, Q334E, G359S, A371V, A376S, K390R  
>8091-30926| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICTELEEEGKISKIGPENPYNTPV
FAIKKKDGNKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQGEGQWTYQIYQEPFKNLKTGKYARMRSA
HTNDVKQLTEVVQKISTESIVIWGKTPKFRLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006