<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-8081 8081-30812 U.K. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IV, I84IV, L90M L33LF L10I, I13V, N37D, L63P, A71T, V77VI, I93L  
>8081-30812| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVFEEMDLPGRWKPKMIGGIGGFVKVRQYD
QIPIEICGHKTIGTVLIGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y   G190A Y318YF V35T, V106I, D123E, I135T, S162C, I178L, Q197H, L210S, L228R, A272P, I329V, M357T, R358RK, A400AT  
>8081-30812| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDLVI
YQYMDDLYVASDLEIGHHRTKIEELRQHLSRWGFYTPDKKHQKEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVFYDPSKDLIAEVQKQGQGQWTYQIYQEPFKNLKTGKYARTKGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWET

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006