<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-8053 8053-30818 U.K. 2003 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, Y115F, Q151M, M184V A62AV, V75I, F116Y, K219Q K101E, G190GS   P4H, K11T, K32KR, V35T, T39A, V60I, V118VI, K122E, D123N, K173S, Q174K, D177E, V179I, Q207A, R211S, F214FL, V245Q, I293V, P294T, G335D, M357K, R358K, G359S, K366R, A371V, I375V, T377Q A33IV
>8053-30818| codons 1-399
PISHIETVPVTLKPGMDGPKVKQWPLTEEKIRVLTEICAEMEKEGKISKIGPENPYNTPI
FVIKKKNSDKWRKLIDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAFYSIPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRSKNPEIII
YQYVDDLYVSSDLEIGQHRTKIEELRAHLLSWGLTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVTLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYARKKSA
HTNDVRQLTEVVQKVAQESIVIWGKTPKFKLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54S, V82A L33I, F53L L10I, I13A, K14N, A22V, E35D, M36I, K55R, R57K, I62V, L63P, H69K, K70KR, T74S, L89I  
>8053-30818| codons 1-99
PQITLWQRPIVTANIGGQLKEVLLDTGADDTVIEDINLPGRWKPKLIVGIGGLSRVKQYD
QVPIEICGKRAIGSVLVGPTPANIIGRNILTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006